Anti-MED25 Antibody (A305325)

Anti-MED25 Antibody

Rabbit polyclonal antibody to MED25.

WB: 1:500-1:1,000

Arabidopsis thaliana

A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana Med25 (NP_173925.3).

AGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSHSATNLPQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTV

Rabbit

Polyclonal

IgG

Unconjugated

75 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ACID1, Activator interaction domain 1 protein, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92 kDa component, ARC/mediator transcriptional coactivator subunit, ARC/mediator transcriptional coactivator subunit ARC92, ARC92, BVSYS, CMT2B2, DKFZp434K0512, FLJ10193, MED25 protein, MED25_HUMAN, Mediator complex subunit 25, Mediator of RNA polymerase II transcription subunit 25, Mediator of RNA polymerase II transcription, subunit 25 homolog (S cerevisiae), Mediator of RNA polymerase II transcription, subunit 25 homolog (yeast), MGC70671, p78, prostate-derived protein 78 kDa, PTOV2, TCBAP0758