Anti-LRP1 Antibody [ARC0275] (A308211)

Anti-LRP1 Antibody [ARC0275]

Rabbit monoclonal [ARC0275] antibody to LRP1.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 4400-4500 of human LRP1 (Q07954).

PPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLLVLVAGVVFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT

Rabbit

Monoclonal

ARC0275

IgG

Unconjugated

85 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

A2MR, Alpha 2 macroglobulin receptor, alpha 2MR, Alpha-2-macroglobulin receptor, APOER, Apolipoprotein E receptor, APR, CD 91, CD91, CD91 antigen, IGFBP3R, LDL receptor related protein 1, Low density lipoprotein receptor related protein 1, Low density lipoprotein related protein 1, Low-density lipoprotein receptor-related protein 1 intracellular domain, LRP, LRP 1, LRP 515, LRP 85, LRP ICD, LRP-1, LRP-515, LRP-85, LRP1 protein, LRP1A, LRP1_HUMAN, LRP515, LRP85, LRPICD, MGC88725, Prolow density lipoprotein receptor related protein 1, TbetaR V/LRP 1/IGFBP 3 receptor, TbetaRV/LRP1/IGFBP3 receptor, TGFBR 5, TGFBR5, Type V tgf beta receptor