Anti-LGR5 Antibody [ARC0321] (A309062)

Anti-LGR5 Antibody [ARC0321]

Rabbit monoclonal [ARC0321] antibody to LGR5.

WB: 1:500-1:2,000

Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 800-907 of human LGR5/GPR49 (O75473).

VIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL

Rabbit

Monoclonal

ARC0321

IgG

Affinity purification.

110 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

FEX, G protein coupled receptor 49, G protein coupled receptor 67, g protein-coupled receptor fex, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38, GPCR GPR49, GPR 49, GPR 67, GPR49, GPR67, GRP 49, GRP49, HG 38, HG38, Leucine rich repeat containing G protein coupled receptor 5, Leucine-rich repeat-containing G-protein coupled receptor 5, LGR 5, LGR5_HUMAN, MGC117008, Orphan G protein coupled receptor HG38