Anti-Ku70 Antibody [ARC0551] (A80789)

Anti-Ku70 Antibody [ARC0551]

Rabbit monoclonal [ARC0551] antibody to Ku70.

WB, IHC, ICC/IF

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70 (P12956).

PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD

Rabbit

Monoclonal

ARC0551

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

5''-deoxyribose-5-phosphate lyase Ku70, 5''-dRP lyase Ku70, 70 kDa subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP dependent DNA helicase II 70 kDa subunit, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70 kDa subunit, CTC box binding factor 75 kDa subunit, CTC box-binding factor 75 kDa subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku 70, Ku autoantigen p70 subunit, Ku autoantigen, 70kDa, Ku p70, Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen, Thyroid autoantigen 70kD (Ku antigen), Thyroid lupus autoantigen, Thyroid lupus autoantigen p70, Thyroid-lupus autoantigen, TLAA, X ray repair complementing defective repair in Chinese hamster cells 6, X-ray repair complementing defective repair in Chinese hamster cells 6, X-ray repair cross-complementing protein 6, XRCC 6, Xrcc6, XRCC6_HUMAN