Anti-ZAP70 Anticorpo [SBZAP] (FITC) (A281736)

Anti-ZAP70 Antibody [SBZAP] (FITC)

Mouse monoclonal [SBZAP] antibody to ZAP70 (FITC).

This antibody recognises human ZAP-70, a 70kDa tyrosine protein kinase which associates with the T-cell receptor (TCR) zeta chain and undergoes phosphorylation following TCR stimulation. ZAP-70 is primarily expressed in T lymphocytes and natural killer cells, where it plays a key role in T-cell receptor (TCR) signalling. ZAP-70 is also expressed in a population of normal immature B-cells and in B-cells from a sub-set of patients with chronic lymphocytic leukaemia.

Flow Cytometry

Human

Synthetic peptide corresponding to amino acids 280-309 of human ZAP70 conjugated to Keyhole Limpet Haemocyanin.

PQRRIDTLNSDGYTPEPARITSPDKPRPMP

Mouse

Monoclonal

SBZAP

IgG1

100 µg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended. This product is photosensitive and should be protected from light.

Mouse anti Human ZAP 70 antibody, clone SBZAP recognizes human ZAP-70, a 70kDa tyrosine protein kinase which associates with the T-cell receptor (TCR) zeta chain and undergoes phosphorylation following TCR stimulation. ZAP-70 is primarily expressed in T lymphocytes and natural killer cells, where it plays a key role in T-cell receptor (TCR) signalling. ZAP-70 is also expressed in a population of normal immature B-cells and in B-cells from a sub-set of patients with chronic lymphocytic leukaemia (Deglesne et al. 2006).

70 kDa zeta associated protein, 70 kDa zeta-associated protein, 70 KDa Zeta-Associated Protein2, 70 KDa Zeta-Chain Associated Protein, EC 2.7.10, EC 2.7.10.2, FLJ17670, FLJ17679, Selective T cell defect, SRK, STCD, STD, Syk related tyrosine kinase, Syk-related tyrosine kinase, Truncated ZAP kinase, Tyrosine protein kinase ZAP70, Tyrosine-protein kinase ZAP-70, TZK, ZAP 70, ZAP-70, ZAP70_HUMAN, Zeta chain associated protein kinase 70kD, Zeta chain associated protein kinase 70kDa, Zeta chain associated protein kinase 70kDa isoform 1, Zeta chain associated protein kinase 70kDa isoform 2, Zeta chain of T cell receptor associated protein kinase 70, Zeta chain TCR associated protein kinase 70kD, Zeta chain TCR associated protein kinase 70kDa, Zeta-Chain (TCR) Associated ProteinKinase (70 KD), Zeta-Chain Associated Protein Kinase, 70kD

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.