Anti-USP9x Anticorpo (A89096)

Anti-USP9x Antibody

Rabbit polyclonal antibody to USP9x.

WB

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP9X (NP_001034679.2).

MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEA

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Deubiquitinating enzyme FAF X, Deubiquitinating enzyme FAF-X, DFFRX, Drosophila fat facets related X linked, FAF, Fafl, Fam, Fat facets homolog, Fat facets in mammals, Fat facets protein related X linked, Fat facets protein related, X-linked, Fat facets protein-related, hFAM, MRX99, Probable ubiquitin carboxyl terminal hydrolase FAF X, Probable ubiquitin carboxyl-terminal hydrolase FAF-X, Ubiquitin carboxyl-terminal hydrolase FAM, Ubiquitin specific peptidase 9 X linked, Ubiquitin specific peptidase 9, X-linked, Ubiquitin specific processing protease FAF X, Ubiquitin specific protease 9 X chromosome, Ubiquitin thioesterase FAF X, Ubiquitin thiolesterase FAF X, Ubiquitin thiolesterase FAF-X, Ubiquitin-specific protease 9, Ubiquitin-specific-processing protease FAF-X, USP9 (gene name), USP9X_HUMAN, Uubiquitin specific protease 9, X chromosome (fat facets like Drosophila), X chromosome, X-linked