Anti-TNF Receptor II Antibody [22221 (2/220)] (A279134)

Anti-TNF Receptor II Antibody [22221 (2/220)]

Mouse monoclonal [22221 (2/220)] antibody to TNF Receptor II.

This antibody recognises recombinant and native human soluble TNF RII. This antibody neutralizes the biological effect of rhTNF RII, but not rhTNF RI.

WB, IHC-Fr, ELISA, Functional Assays

ELISA: 0.5 - 1.0 µg/m, IHC-Fr: 15 - 25 µg/ml, WB: 1.0 - 2.0 µg/ml, Using the concentrations stated the detection limit is 5 ng/well

Human

E. coli derived recombinant peptide corresponding to amino acids 23 to 257 of human CD120b.

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Mouse

Monoclonal

22221 (2/220)

Protein G affinity chromatography of ascites.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 5% Trehalose.

Store undiluted at -20°C only. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Mouse anti Human CD120b antibody, clone 22221 (2/220) Reacts with recombinant and native human soluble TNF RII. This antibody neutralizes the biological effect of rhTNF RII, but not rhTNF RI.