Anti-TNF Receptor II Anticorpo [22221 (2/220)] (A279134)

Anti-TNF Receptor II Antibody [22221 (2/220)]

Mouse monoclonal [22221 (2/220)] antibody to TNF Receptor II.

This antibody recognises recombinant and native human soluble TNF RII. This antibody neutralizes the biological effect of rhTNF RII, but not rhTNF RI.

WB, IHC-Fr, ELISA, Functional Assays

ELISA: 0.5 - 1.0 µg/m, IHC-Fr: 15 - 25 µg/ml, WB: 1.0 - 2.0 µg/ml, Using the concentrations stated the detection limit is 5 ng/well

Human

E. coli derived recombinant peptide corresponding to amino acids 23 to 257 of human CD120b.

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Mouse

Monoclonal

22221 (2/220)

IgG2a

Unconjugated

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 5% Trehalose.

Store undiluted at -20°C only. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Mouse anti Human CD120b antibody, clone 22221 (2/220) Reacts with recombinant and native human soluble TNF RII. This antibody neutralizes the biological effect of rhTNF RII, but not rhTNF RI.

CD120b, p75, p75 TNF receptor, p75TNFR, p80 TNF alpha receptor, p80 TNF-alpha receptor, Soluble TNFR1B variant 1, TBP-2, TBPII, TNF R II, TNF R2, TNF R75, TNF-R2, TNF-RII, TNFBR, TNFR-II, TNFR1B, TNFR2, TNFR80, TNFRII, Tnfrsf1b, TNR1B_HUMAN, Tumor necrosis factor beta receptor, Tumor necrosis factor binding protein 2, Tumor necrosis factor receptor 2, Tumor necrosis factor receptor superfamily member 1B, Tumor necrosis factor receptor type II, Tumor necrosis factor-binding protein 2