Anti-TIMP2 Anticorpo [D08-1D4] (A280202)

Anti-TIMP2 Antibody [D08-1D4]

Mouse monoclonal [D08-1D4] antibody to TIMP2.

This antibody recognises the human tissue matrix metalloprotease inhibitor (TIMP)-2, a 220 amino acid ~22kDa member of the TIMP family.TIMP-2 is a inhibitor of matrix metalloproteases but can also interact with MT1-MMP to enable the cell-surface activation of pro-MMP-2 (Lambert et al. 2004 and Baker et al. 2002). TIMP-2 selectively inhibits the growth of endothelial cells through an MMP-independent mechanism (Murphy et al. 1993 and Moses et al. 1990).

ELISA

Human

E. coli derived recombinant protein corresponding to amino acids 27-220 of human TIMP-2.

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Mouse

Monoclonal

D08-1D4

IgG1

Unconjugated

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human TIMP-2, clone D08-1D4, recognizes the human tissue matrix metalloprotease inhibitor (TIMP)-2, a 220 amino acid ~22kDa member of the TIMP family.TIMP-2 is a inhibitor of matrix metalloproteases but can also interact with MT1-MMP to enable the cell-surface activation of pro-MMP-2 (Lambert et al. 2004 and Baker et al. 2002). TIMP-2 selectively inhibits the growth of endothelial cells through an MMP-independent mechanism (Murphy et al. 1993 and Moses et al. 1990).

CSC 21K , CSC-21K, CSC21K , D11Bwg1104e, DDC8, Metalloproteinase inhibitor 2 , Metalloproteinase inhibitor 2 precursor , MGC105282, OTTMUSP00000004170, OTTMUSP00000004171, RP23-394O9.2, TIMP 2 , TIMP metallopeptidase inhibitor 2 , TIMP-2, TIMP2_HUMAN, Tissue inhibitor of metalloproteinase 2, Tissue inhibitor of metalloproteinases 2