Anti-TIM 3 Anticorpo [RMT3-23] (FITC) (A281688)

Anti-TIM 3 Antibody [RMT3-23] (FITC)

Rat monoclonal [RMT3-23] antibody to TIM 3 (FITC).

This antibody recognises mouse T-cell immunoglobulin mucin 3, a transmembrane glycoprotein and member of the immunoglobulin superfamily, preferentially expressed by differentiated CD4+ Th1 cells and CD8+ Tc1 (cytotoxic) cells, but not by CD4+ Th2 cells or CD8+ Tc2 cells.Tim-3 acts as a negative regulator of Th1-mediated inflammatory diseases including GVHD, type I diabetes, and EAE (experimental autoimmune encephamyelitis), promotes immunological tolerance, and is a receptor for galectin-9, shown to induce cell death of Th1 cells in vitro. Tim-3 is also involved in the regulation of macrophage activation, acts as a phagocytic receptor, and has been shown to recognize apoptotic cells via the IgV domain.Rat anti Mouse Tim-3 antibody, clone RMT3-23 significantly inhibits the efficient phagocytosis of apoptotic cells by peritoneal exudate Mac1+ cells.

Flow Cytometry

Flow Cytometry: Neat - 1:10, Use 10µl of the suggested working dilution to label 1x10⁶ cells in 100µl. The Fc region of monoclonal antibodies may bind non-specifically to cells expressing low affinity Fc receptors. This may be reduced by using SeroBlock FcR (BUF041A or BUF041B).

Mouse

Tim-3-Ig, consisting of amino acids 1-191 of mouse Tim-3, coupled with the Fc portion of mouse IgG2a.

MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

Rat

Monoclonal

RMT3-23

FITC

Excitation: 490nm, Emission: 525nm

Protein G affinity chromatography of tissue culture supernatant.

100 µg/ml

Liquid

Supplied in Phosphate Buffered Saline with 1% BSA and 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended. This product is photosensitive and should be protected from light.

Rat anti Mouse Tim-3 antibody, clone RMT3-23 recognizes mouse T-cell immunoglobulin mucin 3, a transmembrane glycoprotein and member of the immunoglobulin superfamily, preferentially expressed by differentiated CD4+ Th1 cells and CD8+ Tc1 (cytotoxic) cells, but not by CD4+ Th2 cells or CD8+ Tc2 cells.Tim-3 acts as a negative regulator of Th1-mediated inflammatory diseases including GVHD, type I diabetes, and EAE (experimental autoimmune encephamyelitis), promotes immunological tolerance, and is a receptor for galectin-9, shown to induce cell death of Th1 cells in vitro. Tim-3 is also involved in the regulation of macrophage activation, acts as a phagocytic receptor, and has been shown to recognize apoptotic cells via the IgV domain.Rat anti Mouse Tim-3 antibody, clone RMT3-23 significantly inhibits the efficient phagocytosis of apoptotic cells by peritoneal exudate Mac1+ cells ( Nakayama et al. 2009).

CD366, FLJ14428, HAVcr-2, Havcr2, HAVR2_HUMAN, Hepatitis A virus cellular receptor 2, Kidney injury molecule 3, KIM 3, KIM3, T cell immunoglobulin and mucin domain containing 3, T cell immunoglobulin mucin 3, T-cell immunoglobulin and mucin domain-containing protein 3, T-cell immunoglobulin mucin family member 3, T-cell immunoglobulin mucin receptor 3, T-cell membrane protein 3, TIM-3, TIM3, TIMD-3, TIMD3

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.