Anti-TEAD4 Anticorpo (A14526)

Anti-TEAD4 Antibody

Rabbit polyclonal antibody to TEAD4.

WB

WB: 1:200-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2).

AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI

Rabbit

Polyclonal

IgG

Unconjugated

48 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

EFTR 2, EFTR2, hRTEF 1B, hRTEF1B, MGC9014, OTTHUMP00000238119, OTTHUMP00000238122, OTTHUMP00000238124, Related to TEF 1, Related to TEF1, Related transcription enhancer factor 1B, RTEF1, TCF13L1, TEA domain family member 4, TEAD 4, TEAD-4, TEAD4_HUMAN, TEF 3, TEF3, TEFR 1, TEFR1, Transcription factor 13 (SV40 transcriptional enhancer factor) like 1, Transcription factor 13 like 1, Transcription factor 13-like 1, Transcription factor RTEF 1, Transcription factor RTEF-1, Transcription factor RTEF1, Transcriptional enhancer factor 1 related, Transcriptional enhancer factor 3, Transcriptional enhancer factor TEF 3, Transcriptional enhancer factor TEF-3, Transcriptional enhancer factor TEF3