This antibody recognises Transducin Beta Like 1 X-Linked (TBL1X), also known as SMAP55 and F-box-like/WD repeat-containing protein TBL1X. TBL1X is linked to the X chromosome, while TBL1Y is encoded by the same gene on the Y chromosome, and both are closely related to the co-repressor of nuclear hormone transcription factors TBLR1. Similarly, TBL1X is an F-box-like protein that plays an essential role in the silencing mediator for retinoid and thyroid hormone receptors complex. TBLR1 functions as an oncogene and is upregulated in colorectal cancer, and TBLR1 knockdown has been shown to inhibit invasive growth of head and neck squamous cell carcinoma cells (Li and Wang. 2008).

Applicazioni

Diluizioni consigliate

WB: 1:500 - 1:2,000

Reattività

Human

Immunogeno

Synthetic peptide corresponding to amino acids 100-200 of human TBL1X (NP_005638.1).

Sequenza

LISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEEN

Specie ospite

Rabbit

Clonalità

Polyclonal

Isotipo

IgG

Coniugare

Unconjugated

Concentrazione

Lot Specific

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline with 0.05% ProClin 300 and 50% Glycerol.

Conservazione

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Note generali

Rabbit anti TBL1X antibody recognizes Transducin Beta Like 1 X-Linked (TBL1X), also known as SMAP55 and F-box-like/WD repeat-containing protein TBL1X. TBL1X is linked to the X chromosome, while TBL1Y is encoded by the same gene on the Y chromosome, and both are closely related to the co-repressor of nuclear hormone transcription factors TBLR1 (Zhang et al. 2006). Similarly, TBL1X is an F-box-like protein that plays an essential role in the silencing mediator for retinoid and thyroid hormone receptors complex (Heinen et al. 2016). TBLR1 functions as an oncogene and is upregulated in colorectal cancer, and TBLR1 knockdown has been shown to inhibit invasive growth of head and neck squamous cell carcinoma cells (Li and Wang. 2008).

Sinonimi

EBI, F box like/WD repeat protein TBL1X, F-box-like/WD repeat-containing protein TBL1X, SMAP 55, SMAP55, TBL 1, TBL 1X, TBL1, TBL1X_HUMAN, Transducin (beta) like 1, Transducin (beta) like 1 X linked, Transducin (beta) like 1X linked, Transducin beta like 1 X linked, Transducin beta like 1X, Transducin beta like 1X protein, Transducin beta like protein 1, X linked, Transducin beta-like protein 1X, Transducin-beta-like protein 1, X-linked

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.