Anti-TAP1 Anticorpo (A9816)

Anti-TAP1 Antibody

Rabbit polyclonal antibody to TAP1.

WB

WB: 1:500-1:1,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 524-808 of human TAP1 (NP_000584.2).

IYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE

Rabbit

Polyclonal

IgG

Unconjugated

68 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ABC 17, ABC transporter MHC 1, ABC17, ABCB 2, ABCB2, Antigen peptide transporter 1, APT 1, APT1, ATP binding cassette sub family B (MDR/TAP) member 2, ATP binding cassette sub family B member 2, ATP binding cassette transporter, ATP-binding cassette sub-family B member 2, D6S114E, FLJ26666, FLJ41500, Peptide supply factor 1, Peptide transporter involved in antigen processing 1, Peptide transporter PSF 1, Peptide transporter PSF1, Peptide transporter TAP 1, Peptide transporter TAP1, PSF 1, PSF-1, PSF1, Really interesting new gene 4 protein, RING 4, RING4, TAP 1, TAP1*0102N, TAP1N, TAP1_HUMAN, Transporter 1 ATP binding cassette sub family B, Transporter 1 ATP binding cassette sub family B (MDR/TAP), Transporter associated with antigen processing, Transporter ATP binding cassette major histocompatibility complex 1, Y3