Anti-TAF9 Anticorpo (A13815)

Anti-TAF9 Antibody

Rabbit polyclonal antibody to TAF9.

WB

WB: 1:500-1:2,000

Human, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human TAF9 (NP_057367.1).

MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS

Rabbit

Polyclonal

IgG

Unconjugated

20 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

MGC:1603, MGC:3647, MGC:5067, RNA polymerase II TBP-associated factor subunit G, STAF31/32, TAF17, TAF2G, TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa, TAF9 RNA polymerase II, TATA box-binding protein-associated factor, 32kDa, TAFII31, TAFII32, TAFIID32, TATA box-binding protein-associated factor 2G, TBP associated factor 17 kDa, TBP associated factor 9, TBP associated factor, RNA polymerase II, 32-KD, transcription initiation factor TFIID 31 kD subunit, transcription initiation factor TFIID 31 kDa subunit, transcription initiation factor TFIID 32 kDa subunit, Transcription initiation factor TFIID subunit 9