Anti-SRC3 Anticorpo (A88364)

Anti-SRC3 Antibody

Rabbit polyclonal antibody to SRC3.

WB

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NCOA3 (NP_858045.1).

MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADV

Rabbit

Polyclonal

IgG

Unconjugated

155 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ACTR, AIB 1, AIB-1, AIB1, Amplified in breast cancer 1, Amplified in breast cancer 1 protein, bHLHe42, CAGH 16, CAGH16, CBP interacting protein, CBP-interacting protein, Class E basic helix-loop-helix protein 42, CTG 26, CTG26, KAT13B / AIB1, MGC141848, NCOA 3, NCoA-3, Ncoa3, NCOA3_HUMAN, Nuclear receptor coactivator 3, pCIP, RAC 3, RAC-3, RAC3, Receptor associated coactivator 3, Receptor-associated coactivator 3, SRC 3, SRC-3, Steroid receptor coactivator protein 3, Thyroid hormone receptor activator molecule 1, TNRC14, TNRC16, TRAM 1, TRAM-1, TRAM1