MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

Specie ospite

Rabbit

Clonalità

Polyclonal

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

30 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

NAD dependent deacetylase sirtuin 5, NAD dependent lysine demalonylase and desuccinylase sirtuin 5 mitochondrial, NAD dependent protein deacylase sirtuin 5 mitochondrial, NAD-dependent protein deacylase sirtuin-5, mitochondrial, Regulatory protein SIR2 homolog 5, Silent mating type information regulation 2 S.cerevisiae homolog 5, Sir2 like 5, SIR2-like protein 5, SIR2L5, SIR5_HUMAN, Sirtuin 5, Sirtuin type 5

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (2)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-SIRT5 Antibody (A14975)

Western blot analysis of extracts from normal (control) and SIRT5 knockout (KO) 293T cells, using Anti-SIRT5 Antibody (A14975) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-SIRT5 Antibody (A14975)

Western blot analysis of extracts of various cell lines, using Anti-SIRT5 Antibody (A14975) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.