Ricombinante Ratto IL-1 beta proteinaa (A61594)

Recombinant Rat IL-1 beta Protein

SDS-PAGE

Escherichia coli

Recombinant

Rat

Protein fragment

MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

17.3 kDa

Yes

>96% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

Reconstitution dependent.

Lyophilized from Phosphate Buffered Saline, pH 7.4, with 0.02% Tween 20 and 5% Trehalose.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

Catabolin, H1, Hematopoietin 1 , IFN beta inducing factor , IL 1 , IL 1 beta , IL 1B, IL 1beta, IL1 , IL1 beta, IL1B, IL1B_HUMAN, IL1F2 , Interleukin 1 beta , Interleukin 1 beta precursor , Interleukin-1 beta, LAF, OAF, Osteoclast activating factor , OTTHUMP00000162031, Preinterleukin 1 beta, Preinterleukin beta , Pro interleukin 1 beta