Ricombinante Umano Leptin proteinaa (His Tag) (A63138)

Recombinant Human Leptin Protein (His Tag)

WB, Antibody Production, Protein Assay

Escherichia coli

Recombinant

Human

Protein fragment

TQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

His Tag

>90% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

1mg/ml

Lyophilized from Phosphate Buffered Saline with 0.1% SDS and 1 mM DTT.

Shipped at ambient temperature. Lyophilized: Short term store at 25°C. Long term store desiccated below 0°C. Reconstituted: Store at 4°C. Avoid freeze/thaw cycles.

FLJ94114, LEP, LEPD, Leptin (murine obesity homolog), Leptin (obesity homolog, mouse), Leptin Murine Obesity Homolog, Leptin Precursor Obesity Factor, LEP_HUMAN, OB, Obese protein, Obese, mouse, homolog of, Obesity, Obesity factor, Obesity homolog mouse, Obesity Murine Homolog Leptin, OBS, OTTHUMP00000212285