Ricombinante Umano LEC proteinaa (A61295)

Recombinant Human LEC Protein

Chemotaxis

Escherichia coli

Recombinant

Human

Protein fragment

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

11.2 kDa

Yes

>97% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

1 mg/ml

Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

C-C motif chemokine 16, CCL16, CCL16_HUMAN, Chemokine (C-C motif) ligand 16, Chemokine CC-4, Chemokine LEC, CKb12, HCC-4, HCC4, IL-10-inducible chemokine, IL10 inducible chemokine, ILINCK, LCC-1, LCC1, Liver CC chemokine 1 precursor, Liver expressed chemokine, Liver-expressed chemokine, LMC, Lymphocyte and monocyte chemoattractant, Monotactin 1, Monotactin-1, MTN-1, Mtn1, NCC-4, NCC4, New CC chemokine 4, SCYA16, SCYL4, Small inducible cytokine A16 precursor, Small inducible cytokine subfamily A (Cys Cys) member 16, Small-inducible cytokine A16