Ricombinante Umano Iba1 proteinaa (N-terminal His Tag) (A61801)

Recombinant Human Iba1 Protein (N-terminal His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Full length protein

MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

N-terminal His Tag

17.7 kDa

Lyophilized

500 µg/ml

Lyophilized from 20 mM Tris Buffer, pH 7.5, with 50 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Long term store at -20°C. Reconstituted and aliquoted: Short term (2 weeks) store at 4°C. Long term (2 years) stable at -20°. Avoid freeze/thaw cycles.

AIF 1, AIF-1, Aif1, AIF1 protein, AIF1_HUMAN, Allograft inflammatory factor 1, Allograft inflammatory factor 1 splice variant G, allograft inflammatory factor-1 splice variant Hara-1, balloon angioplasty responsive transcription, BART 1, G1, G1 putative splice variant of allograft inflamatory factor 1, IBA 1, interferon gamma responsive transcript, Interferon responsive transcript 1, interferon responsive transcript factor 1, Ionized calcium binding adapter molecule 1, ionized calcium-binding adapter molecule, Ionized calcium-binding adapter molecule 1, IRT 1, IRT1, Microglia response factor, MRF1, Protein g1