Ricombinante Umano FHIT proteinaa (GST Tag) (A58578)

Recombinant Human FHIT Protein (GST Tag)

ELISA, Inhibition Assays, WB

Escherichia coli

Recombinant

Human

Full length protein

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

43 kDa

Liquid

Lot Specific

Supplied in 50 mM Tris Acetate Buffer, pH 7.5, with 1 mM EDTA and 20% Glycerol.

Shipped at 4°C. Store at -20°C to -80°C, stable for 12 months. Avoid freeze/thaw cycles.

AP3A hydrolase, AP3A hydrolase fragile site 3p14.2, AP3Aase, Bis 5' adenosyl triphosphatase, Bis(5' adenosyl) triphosphatase, Diadenosine 5' 5''' P1 P3 triphosphate hydrolase, Dinucleosidetriphosphatase, FRA 3B, FRA3B, Fragile histidine triad, Fragile histidine triad gene, Fragile histidine triad protein, Tumor suppressor protein