Ricombinante Umano CCL13 proteinaa (A61310)

Recombinant Human CCL13 Protein

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

8.6 kDa

Yes

>96% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

1 mg/ml

Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 130 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

C-C motif chemokine 13, CCL13_HUMAN, Chemokine (C C motif) ligand 13, CK beta 10, CK-beta-10, CKb10, MCP-4, MCP4, MGC17134, Monocyte chemoattractant protein 4, Monocyte chemotactic protein 4, NCC 1, NCC-1, NCC1, New CC chemokine 1, SCYA13, SCYL1, short chain, Small inducible cytokine A13 precursor, Small inducible cytokine subfamily A (Cys Cys) member 13, Small-inducible cytokine A13