Ricombinante Gilthead Seabream IGF1 proteinaa (A63088)

$120
Spese di spedizione
Tempi di consegna
5-8 Giorni lavorativi
Telefono
+1 (314) 370-6046
Lun - Ven, 8:00 - 16:00 AST
E-mail
orders@antibodies.com
Nome
Recombinant Gilthead Seabream IGF1 Protein
Applicazioni
Binding Assay
Sistema di espressione
Escherichia coli
Tipo di proteina
Recombinant
Specie proteiche
Gilthead Seabream
Sequenza
MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK
MW previsto
7,545.4 Da
Biologicamente attivo
Yes
Attività biologica
Binding assays of the 125I-Gealthead Seabream IGF1 to Gilthead Seabream or carp (Cyprinus carpio) sera resulted in high specific binding, indicating the existence of one or more IGF-binding proteins. In binding experiments to crude Gilthead Seabream brain homogenate, using human (h) IGF-I as a ligand, the respective IC50 value of hIGF1 was about fourfold lower than that of Gilthead Seabream IGF-1. Recombinant Gilthead Seabream IGF-1 exhibited mitogenic activity in a mouse mammary gland-derived MME-L1 cell line which was approximately 200-fold lower than that of hIGF1. Binding experiments to intact MME-L1 cells suggests that this difference most likely results from a correspondingly lower affinity for IGF1 receptor in these cells. In contrast, the activities of Gilthead Seabream IGF-I and hIGF-I measured by 35S uptake by gill arches from the goldfish (Carassius auratus) were identical, indicating that the recombinant Gilthead Seabream IGF-I is biologically active.
Purezza
>98% as determined by SEC-HPLC and SDS-PAGE.
Forma del prodotto
Lyophilized
Concentrazione
1mg/ml
Formulazione
Lyophilized from a solution containing 0.02% Sodium Bicarbonate.
Conservazione
Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.
Sinonimi
IBP1, IGF I, IGF IA, IGF IB, IGF-I, IGF1A, IGF1_HUMAN, IGFI, IGFIA, Insulin like growth factor 1, Insulin like growth factor 1 (somatomedin C) , Insulin like growth factor IA, Insulin like growth factor IB, Insulin-like growth factor I, Mechano growth factor, MGF, OTTHUMP00000195080, OTTHUMP00000195081, OTTHUMP00000195082, OTTHUMP00000195083, OTTHUMP00000195084, Somatomedia C, Somatomedin C, Somatomedin-C
Dichiarazione di non responsabilità
Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Prodotti alternativi a Ricombinante Gilthead Seabream IGF1 proteinaa (A63088)

Inizio pagina