MILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLA

Specie ospite

Rabbit

Clonalità

Polyclonal

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

35 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

Cell proliferation-inducing gene 21 protein, GBLP_HUMAN, Gnb2-rs1, Gnb2l1, Guanine nucleotide binding protein (G protein) beta polypeptide 2 like 1, Guanine nucleotide binding protein beta polypeptide 2 like 1, Guanine nucleotide binding protein beta subunit 2 like 1, Guanine nucleotide binding protein beta subunit like protein 12.3, Guanine nucleotide binding protein subunit beta 2 like 1, Guanine nucleotide binding protein subunit beta like protein 12.3, Guanine nucleotide-binding protein subunit beta-2-like 1, Guanine nucleotide-binding protein subunit beta-like protein 12.3, H12.3, HLC-7, Human lung cancer oncogene 7 protein, lung cancer oncogene 7, OTTHUMP00000223704, OTTHUMP00000223870, OTTHUMP00000223891, OTTHUMP00000223893, OTTHUMP00000223900, OTTHUMP00000223902, OTTHUMP00000223930, OTTHUMP00000223931, PIG21, Proliferation inducing gene 21, Protein homologous to chicken B complex protein guanine nucleotide binding, Receptor for activated C kinase, Receptor for activated C kinase 1, Receptor of activated protein kinase C 1

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (1)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-RACK1 Antibody (A89407)

Western blot analysis of extracts of various cell lines, using Anti-RACK1 Antibody (A89407) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST.