Anti-PSAP Anticorpo (A306382)

Name: Anti-PSAP Antibody
Brand: Antibodies.com
SKU: A306382
Price: 470.0 USD
Availability: InStock

Clicca sull'immagine per la visualizzazione estesa

$470

Anticorpo policlonale di coniglio contro PSAP per WB, IHC e ICC/IF.

Garanzia al 100%

Garanzia di corrispondenza del prezzo

Consegna

Spese di spedizione

$40

Tempi di consegna

5-8 Giorni lavorativi

Contattaci

Telefono

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanzie

Garanzia di qualità al 100%

Garanzia di corrispondenza del prezzo

Tag dei prodotti:

Anticorpo Knockout Convalidato

Descrizione Prodotto

Nome

Anti-PSAP Antibody

Descrizione

Rabbit polyclonal antibody to PSAP.

Applicazioni

WB, IHC, ICC/IF

Diluizioni consigliate

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Reattività

Human, Mouse, Rat

Immunogeno

Recombinant fusion protein containing a sequence corresponding to amino acids 275-524 of human PSAP (NP_002769.1).

Sequenza

KEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN

Specie ospite

Rabbit

Clonalità

Polyclonal

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

63 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

A1 activator, Cerebroside sulfate activator, Co-beta-glucosidase, Component C, CSAct, Dispersin, GLBA, Glucosylceramidase activator, Proactivator polypeptide, Proactivator polypeptide precursor, Prosaposin, Prosaposin (sphingolipid activator protein 1), prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy), Protein A, Protein C, SAP-1, SAP-2, SAP1, Saposin A, Saposin B, Saposin B Val, Saposin C, Saposin D, Saposin-D, Saposins, SAP_HUMAN, Sgp1, Sphingolipid activator protein 1, Sphingolipid activator protein 2, Sulfated glycoprotein 1, Sulfatide/GM1 activator

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (11)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-PSAP Antibody (A306382)

Western blot analysis of various lysates, using Anti-PSAP Antibody (A306382) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-PSAP Antibody (A306382)

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Western Blot - Anti-PSAP Antibody (A306382)

Western blot analysis of extracts from wild type(WT) and PSAP Rabbit polyclonal antibody knockout (KO) 293T cells, using Anti-PSAP Antibody (A306382) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded human liver using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 5: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 6: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 7: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 8: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded rat brain using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 9: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded rat kidney using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 10: Immunohistochemistry - Anti-PSAP Antibody (A306382)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-PSAP Antibody (A306382) at a dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 11: Immunofluorescence - Anti-PSAP Antibody (A306382)

Immunofluorescence analysis of U2OS cells using Anti-PSAP Antibody (A306382) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Mostra più immagini