Anti-Proteasome 20S LMP7 Anticorpo (A306731)

Anti-Proteasome 20S LMP7 Antibody

Rabbit polyclonal antibody to Proteasome 20S LMP7.

WB, IHC, ICC/IF

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 163-272 of human PSMB8 (NP_004150.1).

LSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

Rabbit

Polyclonal

IgG

Unconjugated

23 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ALDD, D6S216, D6S216E, Large multifunctional peptidase 7, Large multifunctional protease 7, LMP 7, LMP7, Low molecular mass protein 7, Low molecular weight protein 7, Macropain subunit C13, MGC1491, Multicatalytic endopeptidase complex subunit C13, NKJO, OTTHUMP00000062981, Protease component C13, Proteasome (prosome macropain) subunit beta type 8, Proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7), Proteasome beta 8 subunit, Proteasome catalytic subunit 3i, Proteasome component C13, Proteasome related gene 7, Proteasome subunit beta 5i, Proteasome subunit beta 8, Proteasome subunit beta type, Proteasome subunit beta type 8, Proteasome subunit beta type-8, Proteasome subunit beta-5i, Proteasome subunit Y2, PSB8_HUMAN, PSMB 8, PSMB5i, PSMB8, Really interesting new gene 10 protein, RING 10, RING10, Y2