Anti-Nurr1 Anticorpo (A91728)

Anti-Nurr1 Antibody

Rabbit polyclonal antibody to Nurr1.

WB

WB: 1:500-1:1,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human NR4A2 (NP_006177.1).

IKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPV

Rabbit

Polyclonal

IgG

Unconjugated

67 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

HZF 3, HZF3, Immediate-early response protein NOT, Intermediate early receptor protein, NGFI B/nur77 beta type transcription factor homolog, NOT, Nr4a2, NR4A2_HUMAN, nuclear receptor of T cells, nuclear receptor related 1, Nuclear receptor subfamily 4 group A member 2, Nur related protein 1 homolog, nur related protein-1, human homolog of, Nurr 1, Orphan nuclear receptor NR4A2, Orphan nuclear receptor NURR1, RNR 1, RNR1, T cell nuclear receptor NOT, T-cell nuclear receptor NOT, TINUR, Transcriptionally inducible nuclear receptor, Transcriptionally inducible nuclear receptor related, Transcriptionally inducible nuclear receptor related 1, Transcriptionally-inducible nuclear receptor