EEALSQAKKSVASKTEVKKTRRPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK

Specie ospite

Rabbit

Clonalità

Polyclonal

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

180 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

DKFZp667H044, FLJ20353, Histone lysine N methyltransferase NSD3, Histone-lysine N-methyltransferase NSD3, MGC126766, MGC142029, NSD 3, NSD3_HUMAN, Nuclear set domain containing 3, Nuclear SET domain containing protein 3, Nuclear SET domain-containing protein 3, pp14328, Protein whistle, Whistle, WHSC1 like protein 1, WHSC1-like 1 isoform 9 with methyltransferase activity to lysine, WHSC1-like protein 1, WHSC1L1, WHSC1L1 protein, Wolf Hirschhorn syndrome candidate 1 like 1, Wolf-Hirschhorn syndrome candidate 1-like protein 1

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (2)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-NSD3 Antibody (A11848)

Western blot analysis of extracts of various cell lines, using Anti-NSD3 Antibody (A11848) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 90s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-NSD3 Antibody (A11848)

Western blot analysis of extracts from normal (control) and NSD3/WHSC1L1 knockout (KO) 293T cells, using Anti-NSD3 Antibody (A11848) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.