Anti-NLRP1 Anticorpo (A91527)

Anti-NLRP1 Antibody

Rabbit polyclonal antibody to NLRP1.

WB, IHC, ICC/IF

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1370-1473 of human NLRP1 (NP_127497.1).

PSPLDAPQLLHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLPLSS

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CARD 7, CARD7, Caspase recruitment domain protein 7, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament forming Ced 4 like apoptosis protein, Death effector filament-forming ced-4-like apoptosis protein, DEFCAP, DEFCAP L/S, DKFZp586O1822, KIAA0926, LRR and PYD domains-containing protein 1, NAC, NAC alpha/beta/gamma/delta, NACHT, NACHT leucine rich repeat and PYD containing 1, NACHT leucine rich repeat and PYD pyrin domain containing 1, NACHT leucine rich repeat and pyrin domain containing 1, NACHT LRR and PYD containing protein 1, NALP 1, NALP1, NALP1_HUMAN, NLR family pyrin domain containing 1, NLRP 1, NLRP1 protein, Nucleotide binding domain and caspase recruitment domain, Nucleotide binding oligomerization domain leucine rich repeat and pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, PP 1044, PP1044