Anti-MDA5 Anticorpo [ARC0760] (A308247)

Anti-MDA5 Antibody [ARC0760]

Rabbit monoclonal [ARC0760] antibody to MDA5.

WB

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human MDA5 (Q9BYX4).

PSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQY

Rabbit

Monoclonal

ARC0760

IgG

Unconjugated

135 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CADM-140 autoantigen, Clinically amyopathic dermatomyositis autoantigen 140 kDa, DEAD/H (Asp Glu Ala Asp/His) box polypeptide, DEAD/H box polypeptide, Helicard, Helicase with 2 CARD domains, Hlcd, IDDM 19, IDDM19, IFIH 1, Ifih1, IFIH1_HUMAN, Interferon induced helicase C domain containing protein 1, interferon induced with helicase C domain 1, Interferon induced with helicase C domain protein 1, Interferon-induced helicase C domain-containing protein 1, Interferon-induced with helicase C domain protein 1, MDA 5, MDA-5, Melanoma differentiation associated protein 5, Melanoma differentiation-associated gene 5, Melanoma differentiation-associated protein 5, MGC133047, Murabutide down regulated protein, Murabutide down-regulated protein, RH 116, RH116, RIG I like receptor 2, RLR 2, RNA helicase DEAD box protein 116, RNA helicase-DEAD box protein 116