Anti-Kv1.1 potassium channel Anticorpo (A92621)

Anti-Kv1.1 potassium channel Antibody

Rabbit polyclonal antibody to Kv1.1 potassium channel.

ICC/IF

ICC/IF: 1:50-1:200

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 426-495 of human KCNA1 (NP_000208.2).

QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV

Rabbit

Polyclonal

IgG

Unconjugated

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AEMK, EA1, Episodic ataxia with myokymia, HBK1, HUK1, Kca1 1, Kcna1, KCNA1_HUMAN, Kcpvd, KV1.1, MBK1, mceph, MGC124402, MGC126782, MGC138385, MK1, MK1, mouse, homolog of KV1.1, Potassium channel protein 1, Potassium voltage gated channel shaker related subfamily member 1, Potassium voltage gated channel subfamily A member 1, Potassium voltage gated channel, shaker related subfamily, member 1 (episodic ataxia with myokymia), Potassium voltage-gated channel subfamily A member 1, RBK1, RCK1, Shak, Shaker related subfamily member 1, Voltage gated potassium channel subunit Kv1.1, Voltage-gated K(+) channel HuKI, Voltage-gated potassium channel HBK1, Voltage-gated potassium channel subunit Kv1.1