Anti-Ku80 Anticorpo (A91434)

Anti-Ku80 Antibody

Rabbit polyclonal antibody to Ku80.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 540-732 of human Ku80 (NP_066964.1).

IEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

Rabbit

Polyclonal

IgG

Unconjugated

83 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

86 kDa subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II, ATP dependent DNA helicase II 80 kDa subunit, ATP dependent DNA helicase II 86 Kd subunit, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC box binding factor 85 kDa, CTC box-binding factor 85 kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP 1, KARP1, Ku 80, Ku autoantigen 80kDa, Ku86, Ku86 autoantigen related protein 1, KUB 2, KUB2, Lupus Ku autoantigen protein p86, NFIV, Nuclear factor IV, Thyroid lupus autoantigen, Thyroid-lupus autoantigen, TLAA, X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining), X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5, Xray repair complementing defective repair in Chinese hamster cells 5, XRCC 5, XRCC5, XRCC5_HUMAN