Anti-KIR3DL2 Anticorpo (A12797)

Anti-KIR3DL2 Antibody

Rabbit polyclonal antibody to KIR3DL2.

WB

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 22-340 of human KIR3DL2 (NP_006728.2).

LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH

Rabbit

Polyclonal

IgG

Unconjugated

50 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CD158 antigen like family member K, CD158 antigen-like family member K, CD158k, KI3L2_HUMAN, Killer cell immunoglobulin like receptor 3DL2, killer cell immunoglobulin like receptor KIR3DL2, Killer cell immunoglobulin like receptor, three domains, long cytoplasmic tail, 2, Killer cell immunoglobulin-like receptor 3DL2, KIR antigen 3DL2, Kirl2, MHC class I NK cell receptor, Natural killer associated transcript 4, natural killer cell inhibitory receptor, Natural killer-associated transcript 4, NK associated transcript 4, NK associated transcript 4A, included, NK associated transcript 4B, included, NKAT-4, NKAT4, NKAT4B, p140, p70 natural killer cell receptor clone CL 5, p70 natural killer cell receptor clone CL-5, p70 NK receptor CL 5, p70 NK receptor CL-5