Anti-Integrin alpha 5 Anticorpo (A283710)

Anti-Integrin alpha 5 Antibody

Rabbit polyclonal antibody to Integrin alpha 5.

This antibody recognises CD49 antigen-like family member E, also known as integrin alpha-5 (ITGA5), integrin alpha-F and VLA-5. It belongs to the family of cell surface receptors and mediates signal transduction. CD49e was shown to regulate proliferation and adipogenic differentiation of human adipose derived stem cells. MicroRNA-205 (miR-205) down-regulates CD49e and this impairs triple negative breast cancer cell metastatic traits by inhibiting the Src/Vav2/Rac1 pathway.

WB

WB: 1:500 - 1:2,000

Human, Rat, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 750-1000 of human CD49e.

TVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLW

Rabbit

Polyclonal

IgG

Unconjugated

Approximately 135 kDa in various cell and tissue lysates under reducing conditions

Liquid

Supplied in Phosphate Buffered Saline with 50% Glycerol and 0.02% Sodium Azide.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti CD49e antibody recognizes CD49 antigen-like family member E, also known as integrin alpha-5 (ITGA5), integrin alpha-F and VLA-5. It belongs to the family of cell surface receptors and mediates signal transduction (Liu et al. 2000). CD49e was shown to regulate proliferation and adipogenic differentiation of human adipose derived stem cells (Morandi et al. 2016). MicroRNA-205 (miR-205) down-regulates CD49e and this impairs triple negative breast cancer cell metastatic traits by inhibiting the Src/Vav2/Rac1 pathway (Xiao et al. 2018).

CD49 antigen-like family member E, CD49e, Fibronectin receptor subunit alpha, Fibronectin receptor, alpha subunit, FNRA, Integrin alpha 5 (fibronectin receptor alpha), Integrin alpha-5, Integrin alpha-5 light chain, Integrin alpha-F, Integrin, alpha 5 (fibronectin receptor, alpha polypeptide), ITA5_HUMAN, Itga5, Very late activation protein 5, alpha subunit, VLA-5, VLA5, VLA5A