Anti-Umano IgG Anticorpo [ARC2243] (A309060)

Anti-Human IgG Antibody [ARC2243]

Rabbit monoclonal [ARC2243] antibody to Human IgG.

WB

WB: 1:1,000-1:5,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IgG3 (P01860).

VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSC

Rabbit

Monoclonal

ARC2243

IgG

Unconjugated

60 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

FLJ39988, FLJ40036, FLJ40253, FLJ40587, FLJ40789, FLJ40834, G1m marker, G2m marker, G3m marker, G4m marker, HDC, Heavy chain disease protein, Human immunglobulin G, Ig gamma 1 chain C region, Ig gamma 2 chain C region, Ig gamma 3 chain C region, Ig gamma 4 chain C region, IgG heavy chain locus, IGHG 1, IGHG 2, IGHG 3, IGHG 4, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Gm1, Immunoglobulin Gm3, Immunoglobulin Gm4, Immunoglobulin heavy constant gamma 1, immunoglobulin heavy constant gamma 1 (G1m marker), Immunoglobulin heavy constant gamma 2, immunoglobulin heavy constant gamma 2 (G2m marker), Immunoglobulin heavy constant gamma 3, immunoglobulin heavy constant gamma 3 (G3m marker), Immunoglobulin heavy constant gamma 4, immunoglobulin heavy constant gamma 4 (G4m marker), MGC117419, MGC45809