Anti-Hsp27 Anticorpo (A88684)

Anti-Hsp27 Antibody

Rabbit polyclonal antibody to Hsp27.

WB

WB: 1:500-1:2,000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human HSPB2 (NP_001532.1).

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Rabbit

Polyclonal

IgG

Unconjugated

20 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

28 kDa heat shock protein, CMT2F, DKFZp586P1322, epididymis secretory protein Li 102, Estrogen regulated 24 kDa protein, Estrogen-regulated 24 kDa protein, Heat shock 25kDa protein 1, Heat shock 27 kDa protein, Heat shock 27kD protein 1, Heat shock 27kDa protein, Heat shock 27kDa protein 1, Heat shock 28kDa protein 1, Heat Shock Protein 27, Heat shock protein beta 1, Heat shock protein beta-1, heat shock protein family B (small) member 1, HEL-S-102, HMN2B, HS.76067, Hsp 25, HSP 27, Hsp 28, Hsp B1, Hsp25, Hsp28, HspB1, HSPB1_HUMAN, SRP27, Stress responsive protein 27, Stress-responsive protein 27