Anti-HLA-DQA1 Anticorpo [ARC0564] (A305719)

Anti-HLA-DQA1 Antibody [ARC0564]

Rabbit monoclonal [ARC0564] antibody to HLA-DQA1.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 155-254 of human HLA-DQA1 (P01909).

EGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL

Rabbit

Monoclonal

ARC0564

IgG

Unconjugated

28 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CD, CELIAC1, DC 1 alpha chain, DC alpha, DC-1 alpha chain, DC-alpha, DC1, included, DQ alpha 1 chain, DQ-A1, DQ-DRW9 alpha chain, DQA1_HUMAN, FLJ27088, FLJ27328, Gluten-sensitive enteropathy (celiac disease), GSE, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen, DQ alpha 1 chain, HLA class II histocompatibility antigen, DQ(W3) alpha chain, HLA-DCA, HLA-DQA, HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1, HLADC histocompatibility type, Immune response antigens HIa, included, leucocyte antigen DQA1, leukocyte antigen alpha chain, LOC100133678, LOC100507686, LOC100509457, Major histocompatibility complex, class II, DQ alpha 1, MGC149527, MHC class II antigen, MHC class II DQA1, MHC class II HLA-D alpha glycoprotein, MHC class II HLA-DQ alpha 1, MHC class II surface glycoprotein, MHC HLA-DQ alpha, OTTHUMP00000029141, OTTHUMP00000176885, OTTHUMP00000178551, OTTHUMP00000178552, OTTHUMP00000233817