Anti-Histone H4 Anticorpo (A13282)

Anticorpo policlonale di coniglio contro Histone H4 per WB.

Spese di spedizione
Tempi di consegna
5-8 Giorni lavorativi
Telefono
+1 (314) 370-6046
Lun - Ven, 8:00 - 16:00 AST
E-mail
orders@antibodies.com
Nome
Anti-Histone H4 Antibody
Descrizione
Rabbit polyclonal antibody to Histone H4.
Applicazioni
WB
Diluizioni consigliate
WB: 1:500-1:1,000
Reattività
Human, Mouse, Rat
Immunogeno
A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Histone H4 (NP_003529.1).
Sequenza
RRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Specie ospite
Rabbit
Clonalità
Polyclonal
Isotipo
IgG
Coniugare

Unconjugated

Purificazione
Affinity purification.
Peso molecolare
11 kDa
Forma del prodotto
Liquid
Formulazione
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Conservazione
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sinonimi
dJ160A22.1, dJ160A22.2, dJ221C16.1, dJ221C16.9, FO108, H4, H4 histone family, member A, H4 histone family, member B, H4 histone family, member C, H4 histone family, member D, H4 histone family, member E, H4 histone family, member G, H4 histone family, member H, H4 histone family, member I, H4 histone family, member J, H4 histone family, member K, H4 histone family, member M, H4 histone family, member N, H4 histone, family 2, H4.k, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4/p, H4D, H4F2, H4F2iii, H4F2iv, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4L, H4M, H4_HUMAN, HIST, HIST1 cluster, H4A, HIST1 cluster, H4B, HIST1 cluster, H4C, HIST1 cluster, H4D, HIST1 cluster, H4F, HIST1 cluster, H4H, HIST1 cluster, H4J, HIST1 CLUSTER, H4K, HIST1 CLUSTER, H4L, HIST1H4, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4H, HIST1H4I, HIST1H4J, HIST1H4K, HIST1H4L, HIST2 cluster, H4A, HIST2H4, HIST2H4A, Hist4 cluster, H4, Hist4h4, HISTH4H4, Histone 1 H4a, Histone 1 H4b, Histone 1 H4c, Histone 1 H4d, Histone 1 H4e, Histone 1 H4f, Histone 1 H4h, Histone 1 H4i, Histone 1 H4j, Histone 1 H4k, Histone 1 H4l, histone 1, H4a, histone 1, H4b, histone 1, H4c, histone 1, H4d, histone 1, H4e, histone 1, H4f, histone 1, H4h, histone 1, H4i, histone 1, H4j, histone 1, H4k, histone 1, H4l, Histone 2 H4a, histone 2, H4a, histone 2, H4b, Histone 4 family, member M, histone 4 H4, histone 4, H4, histone cluster 1, H4, histone cluster 1, H4a, histone cluster 1, H4b, histone cluster 1, H4c, histone cluster 1, H4d, histone cluster 1, H4e, histone cluster 1, H4f, histone cluster 1, H4h, histone cluster 1, H4i, histone cluster 1, H4j, histone cluster 1, H4k, histone cluster 1, H4l, histone cluster 2, H4a, histone cluster 2, H4b, histone cluster 4, H4, histone family member, Histone family, member A, Histone family, member B, Histone family, member D, Histone family, member H, Histone family, member I, Histone family, member L, Histone gene cluster 1, H4, Histone gene cluster 1, H4 histone family, member A, Histone gene cluster 1, H4 histone family, member A - Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member B, Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member D, Histone gene cluster 1, H4 histone family, member E, Histone gene cluster 1, H4 histone family, member F, Histone gene cluster 1, H4 histone family, member H, Histone gene cluster 1, H4 histone family, member I, Histone gene cluster 1, H4 histone family, member J, Histone gene cluster 1, H4 histone family, member K, Histone gene cluster 1, H4 histone family, member L, Histone gene cluster 1, H4A, Histone gene cluster 1, H4B, Histone gene cluster 1, H4C, Histone gene cluster 1, H4D, Histone gene cluster 1, H4E, Histone gene cluster 1, H4F, Histone gene cluster 1, H4I, Histone gene cluster 1, H4J, Histone gene cluster 1, H4K, Histone gene cluster 1, H4KJ, Histone gene cluster 2, H4, Histone gene cluster 2, H4 histone family, member A, Histone gene cluster 2, H4A, Histone gene cluster 4, H4, Histone gene cluster 4, H4 histone, histone IV, family 2, methyl histone H4, methylated histone H4, MGC24116
Dichiarazione di non responsabilità
Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Prodotti alternativi a Anti-Histone H4 Anticorpo (A13282)

Inizio pagina