Anti-GTPase HRAS Anticorpo (A81138)

Anti-GTPase HRAS Antibody

Rabbit polyclonal antibody to GTPase HRAS.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human HRAS (NP_005334.1).

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

Rabbit

Polyclonal

IgG

Unconjugated

19 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C BAS/HAS, c H ras, C HA RAS1, c has/bas p21 protein, c ras Ki 2 activated oncogene, c-H-ras, CTLO, GTP and GDP binding peptide B, GTPase HRas, N-terminally processed, H Ras 1, H RASIDX, H-Ras-1, Ha Ras, Ha Ras1 proto oncoprotein, Ha-Ras, HAMSV, Harvey rat sarcoma viral oncogene homolog, Harvey rat sarcoma viral oncoprotein, HRAS, HRAS1, K ras, N ras, p19 H RasIDX protein, p21ras, Ras family small GTP binding protein H Ras, RASH1, RASH_HUMAN, Transformation gene oncogene HAMSV, Transforming protein p21, v Ha ras Harvey rat sarcoma viral oncogene homolog, VH Ras, vHa RAS