Anti-GSTA3 Anticorpo (A306897)

Anti-GSTA3 Antibody

Rabbit polyclonal antibody to GSTA3.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:100

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-222 of human GSTA3 (NP_000838.3).

MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

Rabbit

Polyclonal

IgG

Unconjugated

25 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Glutathione S alkyltransferase A3, Glutathione S aralkyltransferase A3, Glutathione S aryltransferase A3, Glutathione S transferase A3, Glutathione S transferase A3 3, glutathione S transferase A3 subunit, Glutathione S transferase alpha 3, Glutathione S transferase alpha type (Ya), glutathione S transferase Yc 1, glutathione S transferase Yc1 subunit, Glutathione S-transferase A3, Glutathione S-transferase A3-3, Glutathione S-transferase Ya3, Glutathione S-transferase Yc, glutathione transferase A3 subunit, Glutathione transferase alpha 3, GST 2 2, GST AA, GST class alpha, GST class alpha member 3, GST class-alpha member 3, GST Yc1, GSTA 3, GSTA3 3, GSTA3-3, GSTA3_HUMAN, Gstyc, GTA 3, GTA3, MGC22232, S (hydroxyalkyl)glutathione lyase A3, Yc1