Anti-Gremlin 1 Anticorpo (A80831)

Anti-Gremlin 1 Antibody

Rabbit polyclonal antibody to Gremlin 1.

WB

WB: 1:500-1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1).

ERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD

Rabbit

Polyclonal

IgG

Unconjugated

15 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BMP antagonist 1, Cell proliferation inducing gene 2 protein, Cell proliferation-inducing gene 2 protein, CKTSF1B1, colorectal adenoma and carcinoma 1, Cysteine knot superfamily 1, Cysteine knot superfamily 1, BMP antagonist 1, Cysteine knot superfamily BMP antagonist 1, DAN domain family member 2, DAND2, Down regulated in Mos-transformed cells protein, Down-regulated in Mos-transformed cells protein, DRM, grem1, GREM1_HUMAN, GREMLIN, Gremlin 1 homolog, cysteine knot superfamily, Gremlin 1 like protein, Gremlin 1, cysteine knot superfamily, homolog, Gremlin-1, Gremlin1, IHG-2, IHG2, Increased in high glucose 2, Increased in high glucose protein 2, PIG2, Proliferation inducing gene 2, proliferation inducing gene 2 protein