Anti-FOXO3A Anticorpo (A283283)

Anti-FOXO3A Antibody

Rabbit polyclonal antibody to FOXO3A.

This antibody recognises human forkhead box O3A (FOXO3A), also known as FKHLR1 and FOXO3, a ~95 kDa member of the forkhead family of transcription factors.FOXO3A is ubiquitously expressed and is an important regulator of apoptosis and the cell cycle. FOXO3A triggers apoptosis by inducing the expression of genes necessary for cell death.

WB, IHC-P

IHC-P: 10 µg/ml, WB: 2 - 4 µg/ml, This product does not require protein digestion pre-treatment of paraffin sections. This product does not require antigen retrieval using heat treatment prior to staining of paraffin sections.

Human, Bovine, Xenopus, Rat, Monkey, Chicken, Dog, Mouse

Synthetic peptide corresponding to amino acids 600-673 of human FOXO3A conjugated to Keyhole Limpet Haemocyanin.

PVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG

Rabbit

Polyclonal

IgG

500 µg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.5% BSA and <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Rabbit anti FOXO3A antibody recognises human forkhead box O3A (FOXO3A), also known as FKHLR1 and FOXO3, a ~95 kDa member of the forkhead family of transcription factors.FOXO3A is ubiquitously expressed and is an important regulator of apoptosis and the cell cycle. FOXO3A triggers apoptosis by inducing the expression of genes necessary for cell death.

AF6q21, AF6q21 protein, DKFZp781A0677, FKHR2, FKHRL 1, FKHRL1, FKHRL1P2, Forkhead (Drosophila) homolog (rhabdomyosarcoma) like 1, Forkhead box O3, Forkhead box O3A, Forkhead box protein O3, Forkhead box protein O3A, Forkhead Drosophila homolog of in rhabdomyosarcoma like 1, Forkhead homolog (rhabdomyosarcoma) like 1, Forkhead in rhabdomyosarcoma like 1, Forkhead in rhabdomyosarcoma-like 1, FOX O3A, FOXO2, foxo3, FOXO3_HUMAN, MGC12739, MGC31925