Anti-EGFR Anticorpo (A81037)

Name: Anti-EGFR Antibody
Brand: Antibodies.com
SKU: A81037
Price: 335.0 USD
Availability: InStock

$335

Anticorpo policlonale di coniglio contro EGFR per WB, IHC, ICC/IF e IP.

Garanzia al 100%

Garanzia di corrispondenza del prezzo

Consegna

Spese di spedizione

$40

Tempi di consegna

5-8 Giorni lavorativi

Contattaci

Telefono

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanzie

Garanzia di qualità al 100%

Garanzia di corrispondenza del prezzo

Tag dei prodotti:

Endosomal Marker ER Marker

Descrizione Prodotto

Nome

Anti-EGFR Antibody

Descrizione

Rabbit polyclonal antibody to EGFR.

Applicazioni

WB, IHC, ICC/IF, IP

Diluizioni consigliate

WB: 1:500-1:1,000, IHC: 1:50-1:200, IP: 1:50-1:100, ICC/IF: 1:50-1:200

Reattività

Human, Mouse, Rat

Immunogeno

Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2).

Sequenza

QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA

Specie ospite

Rabbit

Clonalità

Polyclonal

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

175 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

9030024J15Rik, AI552599, Avian erythroblastic leukemia viral (v erb b) oncogene homolog , Avian erythroblastic leukemia viral (verbb) oncogene homolog , Cell growth inhibiting protein 40 , Cell proliferation inducing protein 61 , EGF R, EGFR_HUMAN, Epidermal growth factor receptor, Epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , Epidermal growth factor receptor (erythroblastic leukemia viral (v erb b) oncogene homolog avian) , erb-b2 receptor tyrosine kinase 1, Erbb, erbb 1, Erbb1, Errp, Erythroblastic leukemia viral (v erb-b) oncogene homolog, HER1, mENA , NISBD2, Oncogen ERBB, Oncogene ERBB , OTTMUSP00000005385, OTTMUSP00000005386, PIG61, Proto oncogene c ErbB 1, Proto-oncogene c-ErbB-1, Receptor tyrosine protein kinase ErbB 1 , Receptor tyrosine protein kinase ErbB1 , Receptor tyrosine-protein kinase ErbB-1, RP23-295E4.1, SA7, Species antigen 7, Urogastrone, v-erb-b Avian erythroblastic leukemia viral oncogen homolog, wa2, Wa5

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (12)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-EGFR Antibody (A81037)

Western blot analysis of extracts of A-549 cells, using Anti-EGFR Antibody (A81037) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-EGFR Antibody (A81037)

Western blot analysis of extracts of various cell lines, using Anti-EGFR Antibody (A81037) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 180s.

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Western Blot - Anti-EGFR Antibody (A81037)

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Immunohistochemistry - Anti-EGFR Antibody (A81037)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-EGFR Antibody (A81037) at a dilution of 1:150 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 5: Immunohistochemistry - Anti-EGFR Antibody (A81037)

Immunohistochemistry analysis of paraffin-embedded human gastric cancer using Anti-EGFR Antibody (A81037) at a dilution of 1:150 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 6: Immunohistochemistry - Anti-EGFR Antibody (A81037)

Immunohistochemistry analysis of paraffin-embedded mouse testis using Anti-EGFR Antibody (A81037) at a dilution of 1:150 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 7: Immunohistochemistry - Anti-EGFR Antibody (A81037)

Immunohistochemistry analysis of paraffin-embedded mouse spinal cord endothelial cells using Anti-EGFR Antibody (A81037) at a dilution of 1:150 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 8: Immunofluorescence - Anti-EGFR Antibody (A81037)

Immunofluorescence analysis of HeLa cells using Anti-EGFR Antibody (A81037) at a dilution of 1:100. DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 9: Immunofluorescence - Anti-EGFR Antibody (A81037)

Immunofluorescence analysis of NIH/3T3 cells using Anti-EGFR Antibody (A81037) at a dilution of 1:100. DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 10: Immunofluorescence - Anti-EGFR Antibody (A81037)

Immunofluorescence analysis of PC12 cells using Anti-EGFR Antibody (A81037) at a dilution of 1:100. DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 11: Western Blot - Anti-EGFR Antibody (A81037)

Immunoprecipitation analysis of 200µg extracts of HeLa cells using 3µg of Anti-EGFR Antibody (A81037). This Western blot was performed on the immunoprecipitate using Anti-EGFR Antibody (A81037) at a dilution of 1:1000.

Clicca sull'immagine per la visualizzazione estesa

Figure 12: Western Blot - Anti-EGFR Antibody (A81037)

Mostra più immagini

Prodotti alternativi a Anti-EGFR Anticorpo (A81037)

A86603

11 Pubblicazioni

Anti-EGFR Anticorpo [EGFR1]

Anticorpo monoclonale [EGFR1] di topo contro EGFR per Flow Cytometry, IP, IHC-Fr e ICC.

(9)

A95372