Anti-CD59 Anticorpo [ARC0896] (A305532)

Anti-CD59 Antibody [ARC0896]

Rabbit monoclonal [ARC0896] antibody to CD59.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 49-128 of human CD59 (P13987).

DACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

Rabbit

Monoclonal

ARC0896

IgG

Unconjugated

16 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

16.3A5, 1F5, 1F5 antigen, 20 kDa homologous restriction factor, CD 59, CD59 antigen, CD59 antigen complement regulatory protein , CD59 antigen p18 20, CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344), CD59 glycoprotein, CD59 molecule, CD59 molecule complement regulatory protein, Cd59a, CD59_HUMAN, CD_antigen=CD59, Complement regulatory protein, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, HRF 20, HRF-20, HRF20, Human leukocyte antigen MIC11, Ly 6 like protein, Lymphocytic antigen CD59/MEM43, MAC inhibitory protein, MAC IP, MAC-inhibitory protein, MAC-IP, MACIF, MACIP, MEM43, MEM43 antigen, Membrane attack complex (MAC) inhibition factor, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, MGC2354, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18 20, Protectin, Surface antigen recognized by monoclonal, T cell activating protein