Anti-CD23 Anticorpo [ARC0596] (A306068)

Anti-CD23 Antibody [ARC0596]

Rabbit monoclonal [ARC0596] antibody to CD23.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:200

Human, Rat

A synthetic peptide corresponding to a sequence within amino acids 222-321 of human CD23 (P06734).

GLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Rabbit

Monoclonal

ARC0596

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BLAST 2, BLAST-2, Blast2, C type lectin domain family 4 member J, C-type lectin domain family 4 member J, C-type lectin domain family 4, member J, CD 23, CD 23A, CD23 antigen, CD23A, CLEC 4J, CLEC4J, Fc epsilon receptor II, Fc epsilon RII, Fc fragment of IgE low affinity II receptor for, Fc fragment of IgE low affinity II receptor for (CD23), Fc fragment of IgE receptor II, Fc fragment of IgE, low affinity II, receptor for (CD23), Fc of IgE, low affinity II, receptor for (CD23), Fc receptor IgE low affinity II alpha polypeptide, Fc receptor, IgE, low affinity II, alpha polypeptide, isoform CRA_a, Fc-epsilon-RII, FCE 2, FCE2, FCER 2, Fcer2, FCER2A, FCER2_HUMAN, FceRII, IgE binding factor, IgE receptor lymphocyte, IgE-binding factor, IGEBF, Immunoglobulin E binding factor, Immunoglobulin E receptor, low affinity II, Immunoglobulin E-binding factor, Immunoglobulin epsilon chain, LEUKOCYTE ANTIGEN CD23, Low Affinity IgE Receptor, Low affinity immunoglobulin epsilon Fc receptor, Low affinity immunoglobulin epsilon Fc receptor membrane bound form, Low affinity immunoglobulin epsilon Fc receptor soluble form, Ly-42, Ly42, Lymphocyte antigen CD23, Lymphocyte IgE receptor, MGC93219