Anti-CCR3 Anticorpo (A309001)

Anti-CCR3 Antibody

Rabbit polyclonal antibody to CCR3.

WB, IHC

WB: 1:500-1:1,000, IHC: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence within amino acids 146-226 of human CCR3 (NP_001828.1).

TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTL

Rabbit

Polyclonal

IgG

Unconjugated

50 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

B chemokine receptor, b-chemokine receptor, C C chemokine receptor type 3, C C CKR 3, C-C chemokine receptor type 3, C-C CKR-3, CC chemokine receptor 3, CC chemokine receptor type 3, CC CKR 3, CC R3, CC-CKR-3, CCCKR3, CCR 3, CCR-3, CCR3_HUMAN, CD 193, CD193, CD193 antigen, Chemokine (C C motif) receptor 3, chemokine (C-C motif) receptor 3, Chemokine (CC) receptor 1 like 2, Chemokine CC motif receptor 3, Chemokine receptor 3, CK R3, CKR 3, CKR3, CMKB R3, CMKBR 3, CMKBR1L2, CMKBR3, Eosinophil CC chemokine receptor 3, Eosinophil eotaxin receptor, Eotaxin receptor, Macrophage inflammatory protein 1 alpha receptor like 2, MGC102841, MIP1 Alpha RL2