Anti-Cathepsin H Anticorpo (A283699)

Anti-Cathepsin H Antibody

Rabbit polyclonal antibody to Cathepsin H.

This antibody recognises pro-cathepsin H, also known as CTSH and CPSB. Cathepsin H is a lysosomal cysteine protease that is synthesized as an inactive proenzyme composed of prodomain and catalytic domains. It is currently unclear if the processing/cleavage of the proenzyme is performed by an autocatalytic method or requires other enzymes for its activation. Cathepsin H has been reported to be overexpressed in human prostate tumor cells.

WB

WB: 1:500 - 1:2,000

Human

Synthetic peptide corresponding to amino acids 70-150 of the internal region of human cathepsin H.

NGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGAL

Rabbit

Polyclonal

IgG

Unconjugated

Approximately 40 kDa in HEK 293 cell lysate

Liquid

Supplied in Phosphate Buffered Saline with 0.5% BSA, 25% Glycerol, and <0.1% Sodium Azide.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti Cathepsin H antibody recognizes pro-cathepsin H, also known as CTSH and CPSB. Cathepsin H is a lysosomal cysteine protease that is synthesized as an inactive proenzyme composed of prodomain and catalytic domains. It is currently unclear if the processing/cleavage of the proenzyme is performed by an autocatalytic method (Rojnik et al. 2012) or requires other enzymes for its activation (Hao et al. 2018). Cathepsin H has been reported to be overexpressed in human prostate tumor cells (Waghray et al. 2002).

ACC 4, ACC 5, ACC4, ACC5, aleurain, cathepsin B3, cathepsin BA, Cathepsin H heavy chain, Cathepsin H light chain, Cathepsin H mini chain, CathepsinB3, CathepsinBA, CathepsinH, CATH_HUMAN, CPSB, CTSH, DKFZp686B24257, MGC1519, minichain, N benzoylarginine beta naphthylamide hydrolase, N-benzoylarginine-beta-naphthylamide hydrolase, pro cathepsin H