Anti-ARID1A Anticorpo (A306631)

Anti-ARID1A Antibody

Rabbit polyclonal antibody to ARID1A.

WB

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 2195-2285 of human ARID1A (NP_006006.3).

LLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

actin-dependent regulator of chromatin subfamily F member 1, ARI1A_HUMAN, ARID domain containing protein 1A, ARID domain-containing protein 1A, AT rich interactive domain 1A, AT rich interactive domain 1A (SWI like), AT rich interactive domain containing protein 1A, AT-rich interactive domain-containing protein 1A, B120, BAF250, BAF250A, BM029, brain protein 120, BRG1 associated factor 250, BRG1 associated factor 250a, BRG1-associated factor 250, BRG1-associated factor 250a, C1ORF4, chromatin remodeling factor p250, chromosome 1 open reading frame 4, ELD, hELD, hOSA1, matrix-associated, MRD14, Osa homolog 1, OSA1, OSA1 nuclear protein, P270, SMARCF1, SWI like protein, SWI SNF complex protein p270, SWI-like protein, SWI/SNF complex protein p270, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1, SWI/SNF-related