Anti-Amyloid Precursor Proteina Anticorpo (A80556)

Anti-Amyloid Precursor Protein Antibody

Rabbit polyclonal antibody to Amyloid Precursor Protein.

ICC/IF

ICC/IF: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APP (NP_000475.1).

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKR

Rabbit

Polyclonal

IgG

Unconjugated

100 - 140 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

A4 amyloid protein, A4_HUMAN, AAA, ABETA, ABPP, AD1, AICD-50, AICD-57, AICD-59, AID(50), AID(57), AID(59), Alzheimer disease amyloid protein, Amyloid beta (A4) precursor protein, Amyloid beta A4 protein, Amyloid beta protein, Amyloid intracellular domain 50, Amyloid intracellular domain 57, Amyloid intracellular domain 59, APP, APPI, Beta amyloid peptide, Beta-amyloid precursor protein, Beta-APP40, Beta-APP42, C31, Cerebral vascular amyloid peptide, CTFgamma, CVAP, Gamma-CTF(50), Gamma-CTF(57), Gamma-CTF(59), peptidase nexin II, PN 2, PN II, PN-II, PN2, PreA4, Protease nexin II, Protease nexin-II, S-APP-alpha, S-APP-beta