Anti-ABCA4 Anticorpo (A12996)

Anti-ABCA4 Antibody

Rabbit polyclonal antibody to ABCA4.

WB, IF

WB: 1:1000-1:2000, IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 110-300 of human ABCA4 (NP_000341.2).

QELLMNAPESQHLGRIWTELHILSQFMDTLRTHPERIAGRGIRIRDILKDEETLTLFLIKNIGLSDSVVYLLINSQVRPEQFAHGVPDLALKDIACSEALLERFIIFSQRRGAKTVRYALCSLSQGTLQWIEDTLYANVDFFKLFRVLPTLLDSRSQGINLRSWGGILSDMSPRIQEFIHRPSMQDLLWVT

Rabbit

Polyclonal

IgG

Unconjugated

256kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ABC 10, ABC A4, ABC transporter, retinal-specific, ABC10, ABCA 4, ABCA4_HUMAN, ABCR, ARMD 2, ARMD2, ATP binding cassette 10, ATP binding cassette sub family A member 4, ATP binding cassette sub family A member4, ATP binding cassette transporter, ATP binding cassette transporter retinal specific, ATP binding cassette, sub family A (ABC1), member 4, ATP binding cassette, sub family A (ABC1), member4, ATP binding cassette10, ATP binding transporter, retina specific, ATP-binding cassette sub-family A member 4, CORD 3, CORD3, DKFZp781N1972, FFM, FLJ17534, Photoreceptor rim protein, Retina specific ABC transporter, Retinal specific ATP binding cassette transporter, Retinal-specific ATP-binding cassette transporter, RIM ABC transporter, RIM protein, RmP, RP 19, RP19, Stargardt disease protein, STGD, STGD1