Anti-IRF3 Antibody [3F10] (A279303)

Anti-IRF3 Antibody [3F10]

Mouse monoclonal [3F10] antibody to IRF3.

This antibody recognises human interferon regulatory factor 3 (IRF3), a ~55 kDa constitutively expressed member of the IRF family, which acts as vital regulator of gene expression in innate immunity. IRF3 accumulates in an inactive form in the cytoplasm and then translocates to the nucleus as a homodimer, following stimuli-induced phosphorylation of specific serine/threonine residues. Association of the homodimer with p300/CBP (CREBB binding protein) forms dsRNA-activated factor 1 (DRAF1), which then activates the transcription of interferon alpha and beta and subsequent downstream interferon-induced genes.

ELISA, WB, IP

WB: 1:1,000 - 1:3,000

Human

Recombinant human IRF3 (amino acids 108-166) purified from E. coli.

EFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEP

Mouse

Monoclonal

3F10

IgG1

Unconjugated

1 mg/ml

Approximately 55 kDa in HeLa cell lysates.

Liquid

Supplied in Phosphate Buffered Saline with 0.01% Sodium Azide and 10% Glycerol.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human IRF3 antibody, clone 3F10 recognizes human interferon regulatory factor 3 (IRF3), a ~55 kDa constitutively expressed member of the IRF family, which acts as vital regulator of gene expression in innate immunity (Nociari et al. 2007).IRF3 accumulates in an inactive form in the cytoplasm and then translocates to the nucleus as a homodimer, following stimuli-induced phosphorylation of specific serine/threonine residues. Association of the homodimer with p300/CBP (CREBB binding protein) forms dsRNA-activated factor 1 (DRAF1), which then activates the transcription of interferon alpha and beta and subsequent downstream interferon-induced genes (Weaver et al. 1998).

IIAE7, Interferon regulatory factor 3, IRF 3, IRF-3, IRF3_HUMAN, MGC94729